ZNF131 Antibody - middle region (ARP47575_P050)

Catalog No: ARP47575_P050

WB Suggested Anti-ZNF131 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF131
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF131 (ARP47575_P050) antibody is Catalog # AAP47575 (Previous Catalog # AAPP28437)
• Reference: Donaldson,N.S., (2007) Biochim. Biophys. Acta 1773 (4), 546-555

Target Info

• Gene Symbol: ZNF131
• Gene Full Name: Zinc finger protein 131
• Alias Symbols: ZBTB35, pHZ-10
• NCBI Gene Id: 7690
• Protein Name: Zinc finger protein 131
• Description of Target: ZNF131 may be involved in transcriptional regulation. It plays a role during development and organogenesis as well as in the function of the adult central nervous system.
• Uniprot ID: P52739-2
• Protein Accession #: NP_003423
• Nucleotide Accession #: NM_003432
• Protein Size (# AA): 589
• Molecular Weight: 67kDa
• Protein Interactions: FHL2; ESR1; UHRF2; SUMO1; UBC; WDR26; KPNA6; KPNA3; KPNA2; CBX4; SUMO2; SUMO3; BAP1; MORF4L1; MORF4L2;