Search Antibody, Protein, and ELISA Kit Solutions

ZMPSTE24 Antibody - N-terminal region (ARP46665_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP46665_P050-FITC Conjugated

ARP46665_P050-HRP Conjugated

ARP46665_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130755 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ZMPSTE24
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 91%; Zebrafish: 90%
Complete computational species homology data:
Anti-ZMPSTE24 (ARP46665_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ZMPSTE24 (ARP46665_P050) antibody is Catalog # AAP46665 (Previous Catalog # AAPS21603)
Datasheets/Manuals:
Printable datasheet for anti-ZMPSTE24 (ARP46665_P050) antibody
Target Reference:
Moulson,C.L., (2005) J. Invest. Dermatol. 125 (5), 913-919
Gene Symbol:
ZMPSTE24
Official Gene Full Name:
Zinc metallopeptidase STE24 homolog (S. cerevisiae)
Alias Symbols:
FACE-1, FACE1, FLJ14968, STE24, Ste24p, HGPS, PRO1
NCBI Gene Id:
10269
Protein Name:
CAAX prenyl protease 1 homolog
Description of Target:
ZMPSTE24 is a member of the peptidase M48A family. This protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in ZMPSTE24 gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.The protein encoded by this gene is a zinc metalloprotease similar to yeast Ste24p. It is an integral membrane protein belonging to peptidase family M48 and is found in the endoplasmic reticulum and possibly in the Golgi compartment. It is thought to be involved in the proteolytic processing of farnesylated proteins.
Swissprot Id:
O75844
Protein Accession #:
NP_005848
Nucleotide Accession #:
NM_005857
Protein Size (# AA):
475
Molecular Weight:
55kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZMPSTE24.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZMPSTE24.
Protein Interactions:
UBC; BAG3; KIAA2013; TMEM43; MRPL40; MRPS5; SYNJ2BP; ATP6V1H; HNRNPUL1; RAB10; VDAC1; UQCRFS1P1; S100A10; RAB5C; PTPN1; NDUFB7; MGST3; HNRNPF; GALNT2; DDOST; CD55; ELAVL1; MME;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...