Search Antibody, Protein, and ELISA Kit Solutions

ZFP36L1 Antibody - N-terminal region (ARP33381_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33381_T100-FITC Conjugated

ARP33381_T100-HRP Conjugated

ARP33381_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Zinc finger protein 36, C3H type-like 1
NCBI Gene Id:
Protein Name:
Zinc finger protein 36, C3H1 type-like 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B
Replacement Item:
This antibody may replace item sc-134091 from Santa Cruz Biotechnology.
Description of Target:
ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZFP36L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZFP36L1.
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-ZFP36L1 (ARP33381_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZFP36L1 (ARP33381_T100) antibody is Catalog # AAP33381
Printable datasheet for anti-ZFP36L1 (ARP33381_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat

Target Reference:
Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...