Zfp354a Antibody - C-terminal region (ARP50736_P050)

Catalog No: ARP50736_P050

WB Suggested Anti-Zfp354a Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse thymus

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SSALIQHRRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Zfp354a (ARP50736_P050) antibody is Catalog # AAP50736

Target Info

• Gene Symbol: Zfp354a
• Gene Full Name: Zinc finger protein 354A
• Alias Symbols: kid, kid1, Tcf17, Znf354a, AW488485
• NCBI Gene Id: 21408
• Protein Name: Glomulin
• Description of Target: Zfp354a may play a role in renal development and may also be involved in the repair of the kidney after ischemia-reperfusion or folic acid administration.
• Uniprot ID: Q92990
• Protein Accession #: NP_444504
• Nucleotide Accession #: NM_053274
• Protein Size (# AA): 572
• Molecular Weight: 66kDa
• Protein Interactions: Myocd; Ssbp2; Trim28;