Catalog No: ARP31586_T100
Price: $0.00
SKU
ARP31586_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ZFP1 (ARP31586_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZFP1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI
Concentration1.0 mg/ml
Blocking PeptideFor anti-ZFP1 (ARP31586_T100) antibody is Catalog # AAP31586
ReferenceChowdhury,K., et al., (1989) Nucleic Acids Res. 17 (24), 10427-10438
Gene SymbolZFP1
Gene Full NameZinc finger protein 1 homolog (mouse)
Alias SymbolsZNF475
NCBI Gene Id162239
Protein NameZinc finger protein 1 homolog
Description of TargetZFP1 is part of a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers.
Uniprot IDQ6P2D0-2
Protein Accession #NP_710155
Nucleotide Accession #NM_153688
Protein Size (# AA)352
Molecular Weight41kDa
Protein InteractionsUBC; CBX5; HDAC2; Trim28;
  1. What is the species homology for "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog".

  2. How long will it take to receive "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZFP1 Antibody - N-terminal region (ARP31586_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    This target may also be called "ZNF475" in publications.

  5. What is the shipping cost for "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZFP1 Antibody - N-terminal region (ARP31586_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZFP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZFP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZFP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZFP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZFP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZFP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZFP1 Antibody - N-terminal region (ARP31586_T100)
Your Rating
We found other products you might like!