- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for ZBTB7A Antibody (OAAL00682) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 2A2 |
Isotype | IgG2a Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | ZBTB7A (AAH19108, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | ZBTB7A |
---|---|
Gene Full Name | zinc finger and BTB domain containing 7A |
Alias Symbols | factor binding IST protein 1;factor that binds to inducer of short transcripts protein 1;FBI1;FBI-1;HIV-1 1st-binding protein 1;HIV-1 inducer of short transcripts binding protein;leukemia/lymphoma-related factor;LRF;lymphoma related factor;POK erythroid myeloid ontogenic factor;pokemon;pokemon 1;POZ and Krueppel erythroid myeloid ontogenic factor;TIP21;TTF-I-interacting peptide 21;ZBTB7;zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein;zinc finger and BTB domain-containing protein 7A;zinc finger protein 857A;ZNF857A. |
NCBI Gene Id | 51341 |
Protein Name | Homo sapiens zinc finger and BTB domain containing 7A, mRNA (cDNA clone IMAGE:5094995), complete cds|ZBTB7A protein [Homo sapiens] |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH19108 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC019108 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ZBTB7A Antibody (OAAL00682)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "ZBTB7A Antibody (OAAL00682)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "ZBTB7A Antibody (OAAL00682)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ZBTB7A Antibody (OAAL00682)"?
This target may also be called "factor binding IST protein 1;factor that binds to inducer of short transcripts protein 1;FBI1;FBI-1;HIV-1 1st-binding protein 1;HIV-1 inducer of short transcripts binding protein;leukemia/lymphoma-related factor;LRF;lymphoma related factor;POK erythroid myeloid ontogenic factor;pokemon;pokemon 1;POZ and Krueppel erythroid myeloid ontogenic factor;TIP21;TTF-I-interacting peptide 21;ZBTB7;zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein;zinc finger and BTB domain-containing protein 7A;zinc finger protein 857A;ZNF857A." in publications.
-
What is the shipping cost for "ZBTB7A Antibody (OAAL00682)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ZBTB7A Antibody (OAAL00682)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ZBTB7A Antibody (OAAL00682)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ZBTB7A Antibody (OAAL00682)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ZBTB7A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ZBTB7A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ZBTB7A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ZBTB7A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ZBTB7A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ZBTB7A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.