Search Antibody, Protein, and ELISA Kit Solutions

Zbtb7a Antibody - C-terminal region (ARP39212_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39212_P050-FITC Conjugated

ARP39212_P050-HRP Conjugated

ARP39212_P050-Biotin Conjugated

Gene Symbol:
Zbtb7a
Official Gene Full Name:
Zinc finger and BTB domain containing 7a
NCBI Gene Id:
16969
Protein Name:
Zinc finger and BTB domain-containing protein 7A
Swissprot Id:
O88939
Protein Accession #:
NP_034861
Nucleotide Accession #:
NM_010731
Alias Symbols:
9030619K07Rik, 9130006G12Rik, AI452336, FBI-1, Lrf, Pokemon, Zbtb7
Replacement Item:
This antibody may replace item sc-33683 from Santa Cruz Biotechnology.
Description of Target:
Zbtb7a plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Zbtb7a specifically represses the transcription of the CDKN2A gene. Zbtb7a efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Zbtb7a binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
Protein Size (# AA):
569
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Zbtb7a.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Zbtb7a.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Complete computational species homology data:
Anti-Zbtb7a (ARP39212_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Sox9; ZBTB7B; Cdkn2a;
Blocking Peptide:
For anti-Zbtb7a (ARP39212_P050) antibody is Catalog # AAP39212
Datasheets/Manuals:
Printable datasheet for anti-Zbtb7a (ARP39212_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...