Search Antibody, Protein, and ELISA Kit Solutions

ZBTB46 Antibody - middle region (ARP50691_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50691_P050-FITC Conjugated

ARP50691_P050-HRP Conjugated

ARP50691_P050-Biotin Conjugated

Gene Symbol:
ZBTB46
Official Gene Full Name:
Zinc finger and BTB domain containing 46
NCBI Gene Id:
140685
Protein Name:
cDNA FLJ16656 fis, clone TESTI4038779, weakly similar to Rattus norvegicus zinc finger protein RIN ZF (RINZF) EMBL BAD18627.1
Swissprot Id:
Q6ZMU8
Protein Accession #:
NP_079500
Nucleotide Accession #:
NM_025224
Alias Symbols:
BTBD4, FLJ13502, RINZF, ZNF340, dJ583P15.7, dJ583P15.8
Replacement Item:
This antibody may replace item sc-72668 from Santa Cruz Biotechnology.
Description of Target:
ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation.
Protein Size (# AA):
589
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZBTB46.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZBTB46.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ZBTB46
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Complete computational species homology data:
Anti-ZBTB46 (ARP50691_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CUL1; DESI1; SUMO1; UBC; ELAVL1;
Blocking Peptide:
For anti-ZBTB46 (ARP50691_P050) antibody is Catalog # AAP50691 (Previous Catalog # AAPP43824)
Datasheets/Manuals:
Printable datasheet for anti-ZBTB46 (ARP50691_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...