ZBTB16 Antibody - C-terminal region (ARP38723_P050)

Catalog No: ARP38723_P050

WB Suggested Anti-ZBTB16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate

Lanes:
1. 50 ug untransfected HEK293T lysate
2. 50 ug ZBTB16 transfected HEK293T lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Donkey Anti-rabbit AP
Secondary Antibody Dilution:
1:2000
Gene Name:
ZBTB16
Submitted by:
Anonymous

Lanes:
1. 50 ug untransfected HEK293T lysate
2. 50 ug ZBTB16 transfected HEK293T lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Donkey Anti-rabbit AP
Secondary Antibody Dilution:
1:2000
Gene Name:
ZBTB16
Submitted by:
Anonymous

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZBTB16
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZBTB16 (ARP38723_P050) antibody is Catalog # AAP38723 (Previous Catalog # AAPP20930)

Target Info

• Reference: Kang,S.I., (2008) Biochem. Biophys. Res. Commun. 369 (4), 1209-1214
• Gene Symbol: ZBTB16
• Gene Full Name: Zinc finger and BTB domain containing 16
• Alias Symbols: PLZF, ZNF145
• NCBI Gene Id: 7704
• Protein Name: Zinc finger and BTB domain-containing protein 16
• Description of Target: ZBTB16 is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.
• Uniprot ID: Q05516
• Protein Accession #: NP_005997
• Nucleotide Accession #: NM_006006
• Protein Size (# AA): 673
• Molecular Weight: 74kDa
• Protein Interactions: KRT40; SH2D4A; TRIM54; LAMTOR5; IL32; ZBTB16; SUMO2; PRKCE; GOLGA2; HDAC1; CEBPA; EP300; MBD3; SIN3A; CBX5; NCOR1; MTA2; HDAC3; TP53; NCOR2; ZNF281; TAB2; SMAD3; CFH; ADAMTS4; HOXA1; CASP3; ATP7B; PARP1; TIMP1; FSHR; EEF1A1; TNK2; ATP6AP2; HDAC4; Gne; Gna