ZAK Antibody (OAAL00701)

Catalog No: OAAL00701

Size:100UG

Detection limit for recombinant GST tagged ZAK is approximately 0.03ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1D5
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: MAP3K20
• Gene Full Name: mitogen-activated protein kinase kinase kinase 20
• Alias Symbols: AZK;CNM6;HCCS-4;human cervical cancer suppressor gene 4 protein;mitogen-activated protein kinase kinase kinase 20;mitogen-activated protein kinase kinase kinase MLT;mixed lineage kinase 7;mixed lineage kinase with a leucine zipper and a sterile alpha motif;mixed lineage kinase-related kinase MRK-beta;MLK7;mlklak;MLK-like mitogen-activated protein triple kinase;MLT;MLTK;MLTKalpha;MLTKbeta;MRK;pk;SFMMP;sterile alpha motif and leucine zipper containing kinase AZK;ZAK;ZAK1 homolog, leucine zipper and sterile-alpha motif kinase.
• NCBI Gene Id: 51776
• Protein Name: Homo sapiens sterile alpha motif and leucine zipper containing kinase AZK, mRNA (cDNA clone MGC:808 IMAGE:3051317), complete cds|Sterile alpha motif and leucine zipper containing kinase AZK [Homo sapiens]
• Description of Target: This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/AAH01401
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/BC001401