YWHAQ Recombinant Protein (Human) (OPCA04806)

Catalog No: OPCA04806

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
• Protein Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-245 aa
• Tag: N-terminal GST-tagged
• Reference: Primary structure of a human protein kinase regulator protein. Nielsen P.J. Biochim. Biophys. Acta 1088:425-428(1991)

Target Info

• Gene Symbol: YWHAQ
• Gene Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
• Alias Symbols: 14-3-3;14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;14-3-3 theta;1C5;HS1;Protein HS1;protein, theta;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide.
• NCBI Gene Id: 10971
• Protein Name: 14-3-3 protein theta
• Description of Target: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
• Uniprot ID: P27348
• Protein Accession #: NP_006817
• Nucleotide Accession #: NM_006826
• Protein Size (# AA): Recombinant
• Molecular Weight: 54.8 kDa