Loading...
Catalog No: AVARP02062_P050
Price: $0.00
SKU
AVARP02062_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-YWHAQ (AVARP02062_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human YWHAQ
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 75%
Peptide SequenceSynthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC
Concentration0.5 mg/ml
Blocking PeptideFor anti-YWHAQ (AVARP02062_P050) antibody is Catalog # AAP30739 (Previous Catalog # AAPP01396)
Sample Type Confirmation

YWHAQ is strongly supported by BioGPS gene expression data to be expressed in SW620

ReferenceChen,C.Y., (2006) Biochem. Biophys. Res. Commun. 342 (4), 1203-1210
Gene SymbolYWHAQ
Gene Full NameTyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Alias Symbols1C5, HS1, 14-3-3
NCBI Gene Id10971
Protein Name14-3-3 protein theta
Description of TargetYWHAQ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Uniprot IDP27348
Protein Accession #NP_006817
Nucleotide Accession #NM_006826
Protein Size (# AA)245
Molecular Weight28kDa
Protein InteractionsUBC; TNFAIP3; TRIM42; RAF1; PIK3R2; PIK3C3; FUS; DTL; MAPT; ABL1; SGK1; SIK3; SUMO2; TUBGCP3; IRS4; HDAC5; HDAC4; STAU1; MDM2; TGM2; SMS; ALDH7A1; YWHAZ; YWHAH; GNAI3; G6PD; EIF5; EEF2; ECHS1; CAPNS1; CAPN1; LDHB; YWHAG; YWHAB; VCL; UBE2V1; TXNDC5; SMEK2;
  1. What is the species homology for "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish".

  2. How long will it take to receive "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "YWHAQ Antibody - N-terminal region (AVARP02062_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    This target may also be called "1C5, HS1, 14-3-3" in publications.

  5. What is the shipping cost for "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "YWHAQ Antibody - N-terminal region (AVARP02062_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "YWHAQ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "YWHAQ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "YWHAQ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "YWHAQ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "YWHAQ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "YWHAQ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:YWHAQ Antibody - N-terminal region (AVARP02062_P050)
Your Rating
We found other products you might like!