SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP02061_P050
Price: $0.00
SKU
AVARP02061_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-YWHAH (AVARP02061_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human YWHAH
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 78%
Peptide SequenceSynthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
Concentration0.5 mg/ml
Blocking PeptideFor anti-YWHAH (AVARP02061_P050) antibody is Catalog # AAP30738 (Previous Catalog # AAPS29813)
ReferenceUbl,A., et al., (2002) Brain Res. Mol. Brain Res. 108 (1-2), 33-39
Gene SymbolYWHAH
Gene Full NameTyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Alias SymbolsYWHA1
NCBI Gene Id7533
Protein Name14-3-3 protein eta
Description of TargetThe YWHAH gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ04917
Protein Accession #NP_003396
Nucleotide Accession #NM_003405
Protein Size (# AA)246
Molecular Weight28kDa
Protein InteractionsDTL; HUWE1; ABL1; SIK3; SUMO2; IRS4; CBL; UBC; UBFD1; EIF5; TBCB; CAPNS1; ALDH7A1; UBE2R2; ISOC1; FERMT2; YWHAQ; PDIA4; YWHAZ; YWHAG; YWHAE; XPO1; VCL; SNRPD2; PCYT2; PTMA; PAK2; PAFAH1B1; MYO1E; HNRNPK; HMGB3; GSS; GNAI3; G6PD; PPP1CA; MARK3; LRRK2; SAV1
  1. What is the species homology for "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Rabbit, Zebrafish".

  2. How long will it take to receive "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "YWHAH Antibody - N-terminal region (AVARP02061_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    This target may also be called "YWHA1" in publications.

  5. What is the shipping cost for "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "YWHAH Antibody - N-terminal region (AVARP02061_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "YWHAH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "YWHAH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "YWHAH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "YWHAH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "YWHAH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "YWHAH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:YWHAH Antibody - N-terminal region (AVARP02061_P050)
Your Rating
We found other products you might like!