Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30643_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30643_P050-FITC Conjugated

ARP30643_P050-HRP Conjugated

ARP30643_P050-Biotin Conjugated

Ywhag Antibody - N-terminal region (ARP30643_P050)

Catalog#: ARP30643_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-113231 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-Ywhag (ARP30643_P050)
Peptide SequenceSynthetic peptide located within the following region: EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Ywhag (ARP30643_P050) antibody is Catalog # AAP30643
Datasheets/ManualsPrintable datasheet for anti-Ywhag (ARP30643_P050) antibody
Gene SymbolYwhag
Official Gene Full NameTyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Alias Symbols14-3-3gamma, D7Bwg1348e
NCBI Gene Id22628
Protein Name14-3-3 protein gamma
Description of TargetYwhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner.
Swissprot IdP61982
Protein Accession #NP_061359
Nucleotide Accession #NM_018871
Protein Size (# AA)247
Molecular Weight28kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Ywhag.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Ywhag.
Protein InteractionsMapt; Kcnma1; Mdm4; Eed; CALM1; Fbxo32; Rara; Rpgrip1l; Ywhaz; Mark3; Mark2; Nedd4l; Htt; Lrrk2; Crk; Ywhae; Lmna; SNCA;
Write Your Own Review
You're reviewing:Ywhag Antibody - N-terminal region (ARP30643_P050)
Your Rating
Aviva Blast Tool
Assay Development
Aviva Tissue Tool
Aviva Live Chat