Search Antibody, Protein, and ELISA Kit Solutions

Ywhag Antibody - N-terminal region (ARP30643_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30643_P050-FITC Conjugated

ARP30643_P050-HRP Conjugated

ARP30643_P050-Biotin Conjugated

Gene Symbol:
Ywhag
Official Gene Full Name:
Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
NCBI Gene Id:
22628
Protein Name:
14-3-3 protein gamma
Swissprot Id:
P61982
Protein Accession #:
NP_061359
Nucleotide Accession #:
NM_018871
Alias Symbols:
14-3-3gamma, D7Bwg1348e
Replacement Item:
This antibody may replace item sc-113231 from Santa Cruz Biotechnology.
Description of Target:
Ywhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner.
Protein Size (# AA):
247
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ywhag.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ywhag.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-Ywhag (ARP30643_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Mapt; Kcnma1; Mdm4; Eed; CALM1; Fbxo32; Rara; Rpgrip1l; Ywhaz; Mark3; Mark2; Nedd4l; Htt; Lrrk2; Crk; Ywhae; Lmna; SNCA;
Blocking Peptide:
For anti-Ywhag (ARP30643_P050) antibody is Catalog # AAP30643
Datasheets/Manuals:
Printable datasheet for anti-Ywhag (ARP30643_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...