YSCF Recombinant Protein (Burkholderia thailandensis) (OPCA05164)

Catalog No: OPCA05164

Product Info

• Predicted Species Reactivity: Burkholderia thailandensis
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR
• Protein Sequence: MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-89 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Bacterial genome adaptation to niches: divergence of the potential virulence genes in three Burkholderia species of different survival strategies. Kim H.S., Schell M.A., Yu Y., Ulrich R.L., Sarria S.H., Nierman W.C., DeShazer D. BMC Genomics 6:174-174(2005)

Target Info

• Gene Symbol: YSCF
• Protein Name: Type III secretion apparatus needle protein
• Uniprot ID: Q2T727
• Protein Size (# AA): Recombinant
• Molecular Weight: 11.4kDa