SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP34450_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP34450_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-YBX2 (ARP34450_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human YBX2
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: RKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPP
Concentration0.5 mg/ml
Blocking PeptideFor anti-YBX2 (ARP34450_T100-FITC) antibody is Catalog # AAP34450 (Previous Catalog # AAPY00412)
ReferenceTekur,S., et al., (1999) J. Androl. 20 (1), 135-144
Gene SymbolYBX2
Gene Full NameY box binding protein 2
Alias SymbolsDBPC, MSY2, CSDA3, CONTRIN
NCBI Gene Id51087
Protein NameY-box-binding protein 2
Description of TargetYBX2 is a member of the Y box multigene family of proteins; it contains the cold shock domain that is highly conserved among all Y box proteins and four basic/aromatic islands. By Northern blotting and immunoblotting, MSY2 appears to be a germ cell-specific protein in the testis. In the ovary, MSY2 is present exclusively in diplotene-stage and mature oocytes. MSY2 is maternally inherited in the one-cell-stage embryo but is not detected in the late two-cell-stage embryo. This loss of MSY2 is coincident with the bulk degradation of maternal mRNAs in the two-cell embryo.
Uniprot IDQ9Y2T7
Protein Accession #NP_057066
Nucleotide Accession #NM_015982
Protein Size (# AA)364
Molecular Weight39kDa
Protein InteractionsIGSF8; HDAC11; ICAM1; UBC;
  1. What is the species homology for "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    This target may also be called "DBPC, MSY2, CSDA3, CONTRIN" in publications.

  5. What is the shipping cost for "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "YBX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "YBX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "YBX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "YBX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "YBX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "YBX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:YBX2 Antibody - middle region : FITC (ARP34450_T100-FITC)
Your Rating
We found other products you might like!