Search Antibody, Protein, and ELISA Kit Solutions

YARS2 Antibody - C-terminal region (ARP67912_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP67912_P050-FITC Conjugated

ARP67912_P050-HRP Conjugated

ARP67912_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Tyrosine--tRNA ligase, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130587 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express YARS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express YARS2.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human YARS2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86%
Peptide Sequence:
Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FAM9B; UBC; BMI1; DDRGK1; CAND1; CUL3; Ybx1; ICT1; USP49; CDC20;
Blocking Peptide:
For anti-YARS2 (ARP67912_P050) antibody is Catalog # AAP67912
Printable datasheet for anti-YARS2 (ARP67912_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...