YARS2 Antibody - C-terminal region (ARP67912_P050)

Catalog#: ARP67912_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Gene Symbol: YARS2
• NCBI Gene Id: 51067
• Protein Name: Tyrosine--tRNA ligase, mitochondrial
• Swissprot Id: Q9Y2Z4
• Protein Accession #: NP_001035526
• Nucleotide Accession #: NM_001040436
• Alias Symbols: MLASA2, MT-TYRRS, TYRRS
• Replacement Item: This antibody may replace item sc-130587 from Santa Cruz Biotechnology.
• Description of Target: This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
• Protein Size (# AA): 477
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express YARS2.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human YARS2
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: FAM9B; UBC; BMI1; DDRGK1; CAND1; CUL3; Ybx1; ICT1; USP49; CDC20;
• Blocking Peptide: For anti-YARS2 (ARP67912_P050) antibody is Catalog # AAP67912

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.