- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- YARS2
- NCBI Gene Id:
- 51067
- Protein Name:
- Tyrosine--tRNA ligase, mitochondrial
- Swissprot Id:
- Q9Y2Z4
- Protein Accession #:
- NP_001035526
- Nucleotide Accession #:
- NM_001040436
- Alias Symbols:
- MLASA2, MT-TYRRS, TYRRS
- Replacement Item:
- This antibody may replace item sc-130587 from Santa Cruz Biotechnology.
- Description of Target:
- This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
- Protein Size (# AA):
- 477
- Molecular Weight:
- 52kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express YARS2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express YARS2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C-terminal region of Human YARS2
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86%
- Peptide Sequence:
- Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- FAM9B; UBC; BMI1; DDRGK1; CAND1; CUL3; Ybx1; ICT1; USP49; CDC20;
- Blocking Peptide:
- For anti-YARS2 (ARP67912_P050) antibody is Catalog # AAP67912
- Datasheets/Manuals:
- Printable datasheet for anti-YARS2 (ARP67912_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
