Catalog No: ARP37341_P050
Price: $0.00
SKU
ARP37341_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-YAF2 (ARP37341_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse YAF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 80%; Dog: 80%; Guinea Pig: 80%; Horse: 80%; Human: 80%; Mouse: 100%; Rat: 80%
Peptide SequenceSynthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE
Concentration0.5 mg/ml
Blocking PeptideFor anti-YAF2 (ARP37341_P050) antibody is Catalog # AAP37341 (Previous Catalog # AAPP09788)
ReferenceKaneko,T., Gene 315, 183-192 (2003)
Gene SymbolYAF2
Gene Full NameYY1 associated factor 2
Alias Symbols2810021M11Rik
NCBI Gene Id67057
Protein NameYY1-associated factor 2
Description of TargetYaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling.
Uniprot IDQ99LW6
Protein Accession #NP_077151
Nucleotide Accession #NM_024189
Protein Size (# AA)179
Molecular Weight20kDa
Protein InteractionsMap3k1; Kdm2b; Rnf2;
  1. What is the species homology for "YAF2 Antibody - middle region (ARP37341_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "YAF2 Antibody - middle region (ARP37341_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "YAF2 Antibody - middle region (ARP37341_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "YAF2 Antibody - middle region (ARP37341_P050)"?

    This target may also be called "2810021M11Rik" in publications.

  5. What is the shipping cost for "YAF2 Antibody - middle region (ARP37341_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "YAF2 Antibody - middle region (ARP37341_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "YAF2 Antibody - middle region (ARP37341_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "YAF2 Antibody - middle region (ARP37341_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "YAF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "YAF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "YAF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "YAF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "YAF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "YAF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:YAF2 Antibody - middle region (ARP37341_P050)
Your Rating
We found other products you might like!