Search Antibody, Protein, and ELISA Kit Solutions

XRCC6 Antibody - N-terminal region (ARP86959_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human XRCC6
Peptide Sequence:
Synthetic peptide located within the following region: SSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-XRCC6 (ARP86959_P050) antibody is Catalog # AAP86959
Datasheets/Manuals:
Printable datasheet for anti-XRCC6 (ARP86959_P050) antibody
Gene Symbol:
XRCC6
Official Gene Full Name:
X-ray repair cross complementing 6
Alias Symbols:
ML8, KU70, TLAA, CTC75, CTCBF, G22P1
NCBI Gene Id:
2547
Protein Name:
X-ray repair cross-complementing protein 6
Description of Target:
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Swissprot Id:
P12956
Protein Accession #:
NP_001275905.1
Nucleotide Accession #:
NM_001288976.1
Protein Size (# AA):
609
Molecular Weight:
70 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express XRCC6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express XRCC6.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...