XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)

Catalog No: ARP58558_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XRCC2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-XRCC2 (ARP58558_P050-HRP) antibody is Catalog # AAP58558 (Previous Catalog # AAPP34583)

Target Info

• Reference: Yen,C.Y., (2008) J. Oral Pathol. Med. 37 (5), 271-277
• Gene Symbol: XRCC2
• Gene Full Name: X-ray repair complementing defective repair in Chinese hamster cells 2
• Alias Symbols: FANCU, POF17, SPGF50
• NCBI Gene Id: 7516
• Protein Name: DNA repair protein XRCC2
• Description of Target: XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O43543
• Protein Accession #: NP_005422
• Nucleotide Accession #: NM_005431
• Protein Size (# AA): 280
• Molecular Weight: 31kDa
• Protein Interactions: RAD51D; MEOX2; WFDC1; NKIRAS1; UBC; RAD51B; RAD51C; RAD51; BLM;