Catalog No: ARP58558_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP58558_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-XRCC2 (ARP58558_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human XRCC2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
Concentration0.5 mg/ml
Blocking PeptideFor anti-XRCC2 (ARP58558_P050-HRP) antibody is Catalog # AAP58558 (Previous Catalog # AAPP34583)
ReferenceYen,C.Y., (2008) J. Oral Pathol. Med. 37 (5), 271-277
Gene SymbolXRCC2
Gene Full NameX-ray repair complementing defective repair in Chinese hamster cells 2
Alias SymbolsFANCU, POF17, SPGF50
NCBI Gene Id7516
Protein NameDNA repair protein XRCC2
Description of TargetXRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO43543
Protein Accession #NP_005422
Nucleotide Accession #NM_005431
Protein Size (# AA)280
Molecular Weight31kDa
Protein InteractionsRAD51D; MEOX2; WFDC1; NKIRAS1; UBC; RAD51B; RAD51C; RAD51; BLM;
  1. What is the species homology for "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    This target may also be called "FANCU, POF17, SPGF50" in publications.

  5. What is the shipping cost for "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "XRCC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "XRCC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "XRCC2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "XRCC2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "XRCC2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "XRCC2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:XRCC2 Antibody - middle region : HRP (ARP58558_P050-HRP)
Your Rating