Search Antibody, Protein, and ELISA Kit Solutions

XPOT antibody - middle region (ARP40711_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40711_P050-FITC Conjugated

ARP40711_P050-HRP Conjugated

ARP40711_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Exportin, tRNA (nuclear export receptor for tRNAs)
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-136346 from Santa Cruz Biotechnology.
Description of Target:
XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.This gene encodes a protein belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express XPOT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express XPOT.
The immunogen is a synthetic peptide directed towards the middle region of human XPOT
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 93%
Complete computational species homology data:
Anti-XPOT (ARP40711_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-XPOT (ARP40711_P050) antibody is Catalog # AAP40711 (Previous Catalog # AAPY00963)
Printable datasheet for anti-XPOT (ARP40711_P050) antibody
Sample Type Confirmation:

XPOT is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Li,S. (2006) RNA Biol 3 (4), 145-149

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...