Search Antibody, Protein, and ELISA Kit Solutions

XPO1 Antibody - C-terminal region (ARP40465_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40465_P050-FITC Conjugated

ARP40465_P050-HRP Conjugated

ARP40465_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Exportin 1 (CRM1 homolog, yeast)
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CRM1, DKFZp686B1823, emb, exp1
Replacement Item:
This antibody may replace item sc-373865 from Santa Cruz Biotechnology.
Description of Target:
XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.The protein encoded by this gene mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express XPO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express XPO1.
The immunogen is a synthetic peptide directed towards the C terminal region of human XPO1
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Complete computational species homology data:
Anti-XPO1 (ARP40465_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-XPO1 (ARP40465_P050) antibody is Catalog # AAP40465 (Previous Catalog # AAPP22233)
Printable datasheet for anti-XPO1 (ARP40465_P050) antibody
Sample Type Confirmation:

XPO1 is supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Target Reference:
Cheong,J.K., (2008) J. Biol. Chem. 283 (17), 11661-11676

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...