XIAP Antibody (Phospho-Ser87) (OAAF07457)

Catalog No: OAAF07457 (Formerly GWB-ASB244)

Size:100 ug

Western blot analysis of lysates from HepG2 cells treated with Anisomycin 25ug/ml 30', using XIAP (Phospho-Ser87) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human skeletal muscle, using XIAP (Phospho-Ser87) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S87 Mouse:S87 Rat:S87
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human XIAP around the phosphorylation site of Ser87.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: LYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSA
• Concentration: 1mg/ml
• Specificity: XIAP (Phospho-Ser87) Antibody detects endogenous levels of XIAP only when phosphorylated at Ser87.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:20000

Target Info

• Gene Symbol: XIAP
• Gene Full Name: X-linked inhibitor of apoptosis
• Alias Symbols: API3;baculoviral IAP repeat-containing protein 4;BIRC4;E3 ubiquitin-protein ligase XIAP;hIAP3;hIAP-3;IAP-3;IAP-like protein;IAP-like protein 1;ILP1;inhibitor of apoptosis protein 3;MIHA;RING-type E3 ubiquitin transferase XIAP;X-linked IAP;X-linked inhibitor of apoptosis protein;X-linked inhibitor of apoptosis, E3 ubiquitin protein ligase;XLP2.
• NCBI Gene Id: 331
• Protein Name: E3 ubiquitin-protein ligase XIAP
• Description of Target: Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, as well as cell invasion and metastasis. Acts as a direct caspase inhibitor. Directly bind to the active site pocket of CASP3 and CASP7 and obstructs substrate entry. Inactivates CASP9 by keeping it in a monomeric, inactive state. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and the target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, CASP3, CASP7, CASP8, CASP9, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS and BIRC5/survivin. Ubiquitinion of CCS leads to enhancement of its chaperone activity toward its physiologic target, SOD1, rather than proteasomal degradation. Ubiquitinion of MAP3K2/MEKK2 and AIFM1 does not lead to proteasomal degradation. Plays a role in copper homeostasis by ubiquitinationg COMMD1 and promoting its proteasomal degradation. Can also function as E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Regulates the BMP signaling pathway and the SMAD and MAP3K7/TAK1 dependent pathways leading to NF-kappa-B and JNK activation. Acts as an important regulator of innate immune signaling via regulation of Nodlike receptors (NLRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Acts as a positive regulator of Wnt signaling and ubiquitinates TLE1, TLE2, TLE3, TLE4 and AES. Ubiquitination of TLE3 results in inhibition of its interaction with TCF7L2/TCF4 thereby allowing efficient recruitment and binding of the transcriptional coactivator beta-catenin to TCF7L2/TCF4 that is required to initiate a Wnt-specific transcriptional program.
• Uniprot ID: P98170
• Molecular Weight: 56 kDa