Search Antibody, Protein, and ELISA Kit Solutions

XAB2 antibody - C-terminal region (ARP50637_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50637_P050-FITC Conjugated

ARP50637_P050-HRP Conjugated

ARP50637_P050-Biotin Conjugated

Gene Symbol:
XAB2
NCBI Gene Id:
56949
Official Gene Full Name:
XPA binding protein 2
Protein Name:
Pre-mRNA-splicing factor SYF1
Swissprot Id:
Q9HCS7
Protein Accession #:
NP_064581
Nucleotide Accession #:
NM_020196
Alias Symbols:
DKFZp762C1015, HCNP, HCRN, NTC90, SYF1
Replacement Item:
This antibody may replace item sc-170495 from Santa Cruz Biotechnology.
Description of Target:
XAB2 belongs to the crooked-neck family. It contains 14 HAT repeats. XAB2 is involved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
Protein Size (# AA):
855
Molecular Weight:
100kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express XAB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express XAB2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human XAB2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Complete computational species homology data:
Anti-XAB2 (ARP50637_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPIE; SUMO2; UBC; WWOX; SUZ12; RNF2; HDAC11; ISY1; SNW1; SF3B2; DHX16; ILF3; IK; EIF4A3; MAGOH; PRPF19; PRPF31; SF3A1; SNRPA1; PLRG1; CUL3; POLR2A; SIRT7; HNRNPA1; GLIS2; Prpf8; Cdc5l; TADA2A; CACHD1; ERCC8; SMAD9; XPA; ERCC6;
Blocking Peptide:
For anti-XAB2 (ARP50637_P050) antibody is Catalog # AAP50637 (Previous Catalog # AAPY03379)
Datasheets/Manuals:
Printable datasheet for anti-XAB2 (ARP50637_P050) antibody
Target Reference:
Kuraoka,I., (2008) J. Biol. Chem. 283 (2), 940-950

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...