Search Antibody, Protein, and ELISA Kit Solutions

WWOX Antibody - N-terminal region : FITC (ARP61393_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61393_P050 Unconjugated

ARP61393_P050-HRP Conjugated

ARP61393_P050-Biotin Conjugated

Gene Symbol:
WWOX
NCBI Gene Id:
51741
Swissprot Id:
Q9NZC7-2
Alias Symbols:
WWOX, FOR, WOX1,
Replacement Item:
This antibody may replace item sc-20528 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induce apoptosis, while defects in this gene are associated with multiple types of cancer. Disruption of this gene is also associated with autosomal recessive spinocerebellar ataxia 12. Disruption of a similar gene in mouse results in impaired steroidogenesis, additionally suggesting a metabolic function for the protein. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
363
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WWOX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WWOX.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human WWOX
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ITCH; TRIM28; HUWE1; UBC; ATM; RPRD2; CYFIP1; SPG20; SNRNP200; ACIN1; SLC4A1AP; DHX30; SCAF8; XRN2; GABARAPL2; SEC23IP; HNRNPUL1; DIDO1; CPSF6; SF3B2; SF3A3; SRSF10; USP39; IGF2BP2; IGF2BP3; IGF2BP1; PAICS; PRPF8; CCT2; CCT7; NOP56; DDX17; SEC23A; BAIAP2;
Blocking Peptide:
For anti-WWOX (ARP61393_P050-FITC) antibody is Catalog # AAP61393
Datasheets/Manuals:
Printable datasheet for anti-WWOX (ARP61393_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...