- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for WTAP Antibody (OAAF07909) |
---|
Predicted Species Reactivity | Human|Mouse |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human WTAP. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
Peptide Sequence | Synthetic peptide located within the following region: TGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSHDPQEEKAVSG |
Concentration | 1mg/ml |
Specificity | WTAP Antibody detects endogenous levels of total WTAP protein. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 ELISA: 1:1000 |
Gene Symbol | WTAP |
---|---|
Gene Full Name | WT1 associated protein |
Alias Symbols | female-lethal(2)D homolog;hFL(2)D;Mum2;PNAS-132;pre-mRNA-splicing regulator WTAP;putative pre-mRNA splicing regulator female-lethal(2D);Wilms tumor 1 associated protein;wilms tumor 1-associating protein;Wilms' tumour 1-associating protein;WT1-associated protein. |
NCBI Gene Id | 9589 |
Protein Name | Pre-mRNA-splicing regulator WTAP |
Description of Target | Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing (PubMed:29507755). Required for accumulation of METTL3 and METTL14 to nuclear speckle (PubMed:24316715, PubMed:24407421, PubMed:24981863). Acts as a mRNA splicing regulator (PubMed:12444081). Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability (PubMed:17088532). Impairs WT1 DNA-binding ability and inhibits expression of WT1 target genes (PubMed:17095724). |
Uniprot ID | Q15007 |
Molecular Weight | 44 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "WTAP Antibody (OAAF07909)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "WTAP Antibody (OAAF07909)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "WTAP Antibody (OAAF07909)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "WTAP Antibody (OAAF07909)"?
This target may also be called "female-lethal(2)D homolog;hFL(2)D;Mum2;PNAS-132;pre-mRNA-splicing regulator WTAP;putative pre-mRNA splicing regulator female-lethal(2D);Wilms tumor 1 associated protein;wilms tumor 1-associating protein;Wilms' tumour 1-associating protein;WT1-associated protein." in publications.
-
What is the shipping cost for "WTAP Antibody (OAAF07909)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "WTAP Antibody (OAAF07909)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "WTAP Antibody (OAAF07909)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "WTAP Antibody (OAAF07909)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "WTAP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "WTAP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "WTAP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "WTAP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "WTAP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "WTAP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.