WSB1 Antibody - middle region (ARP85363_P050)

Catalog No: ARP85363_P050

Host: Rabbit
Target Name: WSB1
Sample Tissue: Human OVCAR-3 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WSB1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: HTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WSB1 (ARP85363_P050) antibody is Catalog # AAP85363

Target Info

• Gene Symbol: WSB1
• Gene Full Name: WD repeat and SOCS box containing 1
• Alias Symbols: SWIP1, WSB-1
• NCBI Gene Id: 26118
• Protein Name: WD repeat and SOCS box-containing protein 1
• Description of Target: This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Uniprot ID: Q9Y6I7
• Protein Accession #: NP_056441.6
• Nucleotide Accession #: NM_015626.8
• Protein Size (# AA): 421
• Molecular Weight: 46 kDa