WNT9B Antibody - C-terminal region : FITC (ARP41243_T100-FITC)

Catalog No: ARP41243_T100-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WNT9B
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WNT9B (ARP41243_T100-FITC) antibody is Catalog # AAP41243 (Previous Catalog # AAPS01410)
• Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Target Info

• Gene Symbol: WNT9B
• Gene Full Name: Wingless-type MMTV integration site family, member 9B
• Alias Symbols: WNT15, WNT14B
• NCBI Gene Id: 7484
• Protein Name: Protein Wnt-9b
• Description of Target: WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neuronal differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region.
• Uniprot ID: O14905
• Protein Accession #: NP_003387
• Nucleotide Accession #: NM_003396
• Protein Size (# AA): 357
• Molecular Weight: 39kDa
• Protein Interactions: MGMT;