Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

WNT5B Antibody - middle region (ARP77732_P050)

Catalog#: ARP77732_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-109464 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WNT5B
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: PKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-WNT5B (ARP77732_P050) antibody is Catalog # AAP77732
Datasheets/Manuals Printable datasheet for anti-WNT5B (ARP77732_P050) antibody
Gene Symbol WNT5B
Official Gene Full Name wingless-type MMTV integration site family member 5B
NCBI Gene Id 81029
Protein Name protein Wnt-5b
Description of Target The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein, respectively. Alternative splicing of this gene generates 2 transcript variants.
Swissprot Id Q9H1J7
Protein Accession # NP_110402.2
Nucleotide Accession # NM_030775.2
Protein Size (# AA) 359
Molecular Weight 39 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express WNT5B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express WNT5B.
Write Your Own Review
You're reviewing:WNT5B Antibody - middle region (ARP77732_P050)
Your Rating