WNT1 Antibody - middle region (ARP32122_P050)

Catalog No: ARP32122_P050

Sample Type: 1. Molecular Weight
2. Control (20ug)
3. shRNA1-WNT1 H9 hES cells (20ug)
4. shRNA2-WNT1 H9 hES cells (20ug)
Primary Dilution: 1:1000
Secondary Antibody: anti-Rabbit HRP
Secondary Dilution: 1:5000
Image Submitted By: Jingli Cai
Thomas Jefferson University 

Host: Rabbit
Target Name: WNT1
Sample Tissue: Human HepG2
Antibody Dilution: 1.0ug/ml

Host: Mouse
Target Name: WNT1
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WNT1 (ARP32122_P050) antibody is Catalog # AAP32122 (Previous Catalog # AAPP03039)
• Reference: David,R., (2008) Nat. Cell Biol. 10 (3), 338-345

Target Info

• Gene Symbol: WNT1
• Gene Full Name: Wingless-type MMTV integration site family, member 1
• Alias Symbols: INT1, OI15, BMND16
• NCBI Gene Id: 7471
• Protein Name: Proto-oncogene Wnt-1
• Description of Target: WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. WNT1 was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. WNT1 is clustered with another family member, WNT10B, in the chromosome 12q13 region.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P04628
• Protein Accession #: NP_005421
• Nucleotide Accession #: NM_005430
• Protein Size (# AA): 370
• Molecular Weight: 38kDa
• Protein Interactions: FZD8; LRP6; POLR2C; ROR2; WIF1; SFRP2; SFRP1; PORCN; WNT3A; LRP5; FZD9; RYK;