ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP64152_P050
Price: $0.00
SKU
ARP64152_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-WISP2 (ARP64152_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: WGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Concentration0.5 mg/ml
Blocking PeptideFor anti-WISP2 (ARP64152_P050) antibody is Catalog # AAP64152
Sample Type Confirmation

WISP2 is supported by BioGPS gene expression data to be expressed in HeLa

Gene SymbolWISP2
Gene Full NameWNT1 inducible signaling pathway protein 2
Alias SymbolsCT58, WISP2, CTGF-L
NCBI Gene Id8839
Protein NameWNT1-inducible-signaling pathway protein 2
Description of TargetThis gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.
Uniprot IDO76076
Protein Accession #NP_003872
Nucleotide Accession #NM_003881
Protein Size (# AA)250
Molecular Weight24kDa
Protein InteractionsHDAC3; HDAC1; IGF1R; IGF2R;
  1. What is the species homology for "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Dog, Horse, Pig".

  2. How long will it take to receive "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WISP2 Antibody - C-terminal region (ARP64152_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    This target may also be called "CT58, WISP2, CTGF-L" in publications.

  5. What is the shipping cost for "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WISP2 Antibody - C-terminal region (ARP64152_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "WISP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WISP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WISP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WISP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WISP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WISP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WISP2 Antibody - C-terminal region (ARP64152_P050)
Your Rating
We found other products you might like!