WIPI1 Antibody - middle region (ARP82165_P050)

Catalog No: ARP82165_P050

Host: Rabbit
Target Name: WIPI1
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WIPI1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WIPI1 (ARP82165_P050) antibody is Catalog # AAP82165

Target Info

• Gene Symbol: WIPI1
• Gene Full Name: WD repeat domain, phosphoinositide interacting 1
• Alias Symbols: ATG18, ATG18A, WIPI49
• NCBI Gene Id: 55062
• Protein Name: WD repeat domain phosphoinositide-interacting protein 1
• Description of Target: This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q5MNZ9
• Protein Accession #: NP_060453.3
• Nucleotide Accession #: NM_017983.5
• Protein Size (# AA): 446
• Molecular Weight: 49 kDa