WDR66 Antibody - middle region (ARP52728_P050)

Catalog No: ARP52728_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: WDR66
Sample Type: Colonrectol Tumor lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human WDR66
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: DLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WDR66 (ARP52728_P050) antibody is Catalog # AAP52728

Target Info

• Gene Symbol: WDR66
• Gene Full Name: WD repeat domain 66
• Alias Symbols: WDR66, SPGF33, CaM-IP4
• NCBI Gene Id: 144406
• Protein Name: WD repeat-containing protein 66
• Description of Target: This protein encoded by this gene belongs to the WD repeat-containing family of proteins, which function in the formation of protein-protein complexes in a variety of biological pathways. This family member appears to function in the determination of mean platelet volume (MPV), and polymorphisms in this gene have been associated with variance in MPV. Alternative splicing of this gene results in multiple transcript variants.
• Uniprot ID: Q8TBY9-3
• Protein Size (# AA): 370
• Molecular Weight: 40kDa
• Protein Interactions: UBC;