Catalog No: OPCA326509
Price: $0.00
SKU
OPCA326509
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ WDR61 Recombinant Protein (Human) (OPCA326509)
Datasheets/Manuals | Printable datasheet for OPCA326509 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | TNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 2-305 |
Gene Full Name | WD repeat domain 61 |
---|---|
Alias Symbols | SKI8, REC14 |
NCBI Gene Id | 80349 |
Protein Name | WD repeat-containing protein 61 |
Description of Target | WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM, Mar 2008] |
Uniprot ID | Q9GZS3 |
Protein Accession # | NP_001290176.1 |
Nucleotide Accession # | NM_001303247.1 |
Protein Size (# AA) | 304 |
Write Your Own Review