WDR5 Antibody (OAAL00563)

Catalog No: OAAL00563

Size:100UG

Detection limit for recombinant GST tagged WDR5 is 0.3 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1B1
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: WDR5 (NP_060058, 16 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: WDR5
• Gene Full Name: WD repeat domain 5
• Alias Symbols: BIG3;BIG-3;BMP2-induced 3-kb gene protein;CFAP89;cilia and flagella associated protein 89;SWD3;SWD3, Set1c WD40 repeat protein, homolog;WD repeat-containing protein 5.
• NCBI Gene Id: 11091
• Protein Name: Homo sapiens WD repeat domain 5 (WDR5), transcript variant 1, mRNA|WD repeat-containing protein 5 [Homo sapiens]
• Description of Target: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_060058
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_017588