Search Antibody, Protein, and ELISA Kit Solutions

WDR4 Antibody - middle region (ARP86385_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
WD repeat domain 4
NCBI Gene Id:
Protein Name:
tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
Molecular Weight:
45 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WDR4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WDR4.
The immunogen is a synthetic peptide directed towards the middle region of human WDR4
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: TEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-WDR4 (ARP86385_P050) antibody is Catalog # AAP86385
Printable datasheet for anti-WDR4 (ARP86385_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...