Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

WDR26 Antibody - C-terminal region : FITC (ARP75793_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75793_P050 Unconjugated

ARP75793_P050-HRP Conjugated

ARP75793_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
WDR26
NCBI Gene Id:
80232
Swissprot Id:
Q9H7D7
Protein Accession #:
NP_079436
Alias Symbols:
WDR26, CDW2, MIP2, PRO0852,
Description of Target:
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
661
Molecular Weight:
72kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WDR26.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WDR26.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR26
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PLCB2; GNB1; Wdr26; PNO1; KCMF1; TSR1; GID8; KIAA0368; RANBP9; RPS26; RPS24; RPS15A; RPS8; RPS7; RPS6; EGFR; SOX2; NPM1; UBC; BARD1; UBE2O; RANBP10; ZNF687; ZNF131; UBD; GNG2; TSG101; ARRB2; UL27; USP46; MAPK6; USP12; UBXN7; FAF2; FAF1; WDR5; CUL4A; CUL4B
Blocking Peptide:
For anti-WDR26 (ARP75793_P050-FITC) antibody is Catalog # AAP75793
Datasheets/Manuals:
Printable datasheet for anti-WDR26 (ARP75793_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...