Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP75793_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP75793_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-WDR26 (ARP75793_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR26
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: MSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC
Concentration0.5 mg/ml
Blocking PeptideFor anti-WDR26 (ARP75793_P050-Biotin) antibody is Catalog # AAP75793
ReferenceN/A
Gene SymbolWDR26
Alias SymbolsCDW2, GID7, MIP2, SKDEAS
NCBI Gene Id80232
Description of TargetThis gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene.
Uniprot IDQ9H7D7
Protein Accession #NP_079436
Protein Size (# AA)661
Molecular Weight72kDa
Protein InteractionsPLCB2; GNB1; Wdr26; PNO1; KCMF1; TSR1; GID8; KIAA0368; RANBP9; RPS26; RPS24; RPS15A; RPS8; RPS7; RPS6; EGFR; SOX2; NPM1; UBC; BARD1; UBE2O; RANBP10; ZNF687; ZNF131; UBD; GNG2; TSG101; ARRB2; UL27; USP46; MAPK6; USP12; UBXN7; FAF2; FAF1; WDR5; CUL4A; CUL4B
  1. What is the species homology for "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    This target may also be called "CDW2, GID7, MIP2, SKDEAS" in publications.

  5. What is the shipping cost for "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "WDR26"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WDR26"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WDR26"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WDR26"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WDR26"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WDR26"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WDR26 Antibody - C-terminal region : Biotin (ARP75793_P050-Biotin)
Your Rating
We found other products you might like!