Search Antibody, Protein, and ELISA Kit Solutions

WDR26 Antibody - C-terminal region (ARP75793_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75793_P050-FITC Conjugated

ARP75793_P050-HRP Conjugated

ARP75793_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
WDR26
NCBI Gene Id:
80232
Swissprot Id:
Q9H7D7
Protein Accession #:
NP_079436
Alias Symbols:
WDR26, CDW2, MIP2, PRO0852,
Description of Target:
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
661
Molecular Weight:
72kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WDR26.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WDR26.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR26
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PLCB2; GNB1; Wdr26; PNO1; KCMF1; TSR1; GID8; KIAA0368; RANBP9; RPS26; RPS24; RPS15A; RPS8; RPS7; RPS6; EGFR; SOX2; NPM1; UBC; BARD1; UBE2O; RANBP10; ZNF687; ZNF131; UBD; GNG2; TSG101; ARRB2; UL27; USP46; MAPK6; USP12; UBXN7; FAF2; FAF1; WDR5; CUL4A; CUL4B
Blocking Peptide:
For anti-WDR26 (ARP75793_P050) antibody is Catalog # AAP75793
Datasheets/Manuals:
Printable datasheet for anti-WDR26 (ARP75793_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...