WDR21A Antibody - middle region : HRP (ARP55299_P050-HRP)

Catalog No: ARP55299_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DCAF4 (ARP55299_P050-HRP) antibody is Catalog # AAP55299 (Previous Catalog # AAPP33130)

Target Info

• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Gene Symbol: DCAF4
• Gene Full Name: DDB1 and CUL4 associated factor 4
• Alias Symbols: WDR21, WDR21A
• NCBI Gene Id: 26094
• Protein Name: DDB1- and CUL4-associated factor 4
• Description of Target: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Uniprot ID: Q8WV16
• Protein Accession #: NP_056419
• Nucleotide Accession #: NM_015604
• Protein Size (# AA): 495
• Molecular Weight: 56kDa
• Protein Interactions: CUL4A; CUL4B; DDB1; SOX30; UBC; COPS5; COPS6; USP7;