Search Antibody, Protein, and ELISA Kit Solutions

WBP11 antibody - N-terminal region (ARP46241_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46241_P050-FITC Conjugated

ARP46241_P050-HRP Conjugated

ARP46241_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
WW domain binding protein 11
Protein Name:
WW domain-binding protein 11
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp779M1063, NPWBP, SIPP1, WBP-11
Replacement Item:
This antibody may replace item sc-161960 from Santa Cruz Biotechnology.
Description of Target:
WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WBP11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WBP11.
The immunogen is a synthetic peptide directed towards the N terminal region of human WBP11
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-WBP11 (ARP46241_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-WBP11 (ARP46241_P050) antibody is Catalog # AAP46241 (Previous Catalog # AAPP27073)
Printable datasheet for anti-WBP11 (ARP46241_P050) antibody
Sample Type Confirmation:

WBP11 is strongly supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...