- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for WAVE1 Antibody (OAAF07873) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Product Format | Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human WAVE1. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
Peptide Sequence | Synthetic peptide located within the following region: SLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPY |
Concentration | 1mg/ml |
Specificity | WAVE1 Antibody detects endogenous levels of total WAVE1 protein. |
Application Info | WB: 1:500~1000 IHC: 1:50~100 IF: 1:100~500 ELISA: 1:40000 |
Gene Symbol | WASF1 |
---|---|
Gene Full Name | WASP family member 1 |
Alias Symbols | homology of dictyostelium scar 1;NEDALVS;protein WAVE-1;SCAR1;verprolin homology domain-containing protein 1;WAS protein family member 1;WASP family protein member 1;WAVE;WAVE1;wiskott-Aldrich syndrome protein family member 1. |
NCBI Gene Id | 8936 |
Protein Name | Wiskott-Aldrich syndrome protein family member 1 |
Description of Target | Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex (By similarity). As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity). |
Uniprot ID | Q92558 |
Molecular Weight | 61 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "WAVE1 Antibody (OAAF07873)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "WAVE1 Antibody (OAAF07873)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "WAVE1 Antibody (OAAF07873)" provided in?
This item is provided in "Liquid (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "WAVE1 Antibody (OAAF07873)"?
This target may also be called "homology of dictyostelium scar 1;NEDALVS;protein WAVE-1;SCAR1;verprolin homology domain-containing protein 1;WAS protein family member 1;WASP family protein member 1;WAVE;WAVE1;wiskott-Aldrich syndrome protein family member 1." in publications.
-
What is the shipping cost for "WAVE1 Antibody (OAAF07873)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "WAVE1 Antibody (OAAF07873)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "WAVE1 Antibody (OAAF07873)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "61 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "WAVE1 Antibody (OAAF07873)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "WASF1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "WASF1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "WASF1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "WASF1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "WASF1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "WASF1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.