Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: OAAF07455-Biotin
Size:100 ug
Price: $379.00
SKU
OAAF07455-Biotin
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)

Datasheets/ManualsPrintable datasheet for OAAF07455-Biotin
Product Info
Predicted Species ReactivityHuman, Mouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB, IHC, ELISA
Additional InformationModification Sites: Human:Y290 Mouse:Y293
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe antiserum was produced against synthesized peptide derived from human WASP around the phosphorylation site of Tyr290.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: NGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQ
Concentration1 mg/ml
SpecificityWASP (Phospho-Tyr290) Antibody detects endogenous levels of WASP only when phosphorylated at Tyr290.
Application InfoWB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:1000
Gene SymbolWAS
Alias SymbolsTHC, IMD2, SCNX, THC1, WASP, WASPA
NCBI Gene Id7454
Uniprot IDP42768
Molecular Weight52 kDa
  1. What is the species homology for "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".

  2. How long will it take to receive "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    This target may also be called "THC, IMD2, SCNX, THC1, WASP, WASPA" in publications.

  5. What is the shipping cost for "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "WAS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WAS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WAS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WAS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WAS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WAS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WASP Antibody (Phospho-Tyr290) : Biotin (OAAF07455-Biotin)
Your Rating
We found other products you might like!