WASF3 Antibody - middle region (ARP52220_P050)

Catalog No: ARP52220_P050

WB Suggested Anti-WASF3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Sample Type: 1. DF-1 cells (0.5x10⁶ cells loaded)
2. MSB-1 cells  (0.5x10⁶ cells loaded)
Primary Dilution: 1:1000 
Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase 
Secondary Dilution:1:10,000 
Image Submitted By: Yongxiu Yao
Institute for Animal Health  

Product Info

• Tested Species Reactivity: Human, Chicken
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WASF3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WASF3 (ARP52220_P050) antibody is Catalog # AAP52220 (Previous Catalog # AAPP14247)
• Reference: Schott,D.R., (2007) J. Biol. Chem. 282 (36), 26257-26265

Target Info

• Gene Symbol: WASF3
• Gene Full Name: WAS protein family, member 3
• Alias Symbols: SCAR3, WAVE3, Brush-1
• NCBI Gene Id: 10810
• Protein Name: Wiskott-Aldrich syndrome protein family member 3
• Description of Target: WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9UPY6
• Protein Accession #: NP_006637
• Nucleotide Accession #: NM_006646
• Protein Size (# AA): 502
• Molecular Weight: 55kDa
• Protein Interactions: CAMK2D; UBC; RYK; ACTR3; PIK3R2; PIK3R1; ACTB;