WARS2 Antibody - middle region (ARP52366_P050)

Catalog No: ARP52366_P050

WB Suggested Anti-WARS2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Host: Rabbit
Target Name: WARS2
Sample Type: Human Fetal Muscle
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane/lane
Gel Concentration: 0.12

Host: Rabbit
Target Name: WARS2
Sample Tissue: Human Stomach Tumor
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WARS2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-WARS2 (ARP52366_P050) antibody is Catalog # AAP52366 (Previous Catalog # AAPP14310)
• Reference: Guo,L.T., (2007) Nucleic Acids Res. 35 (17), 5934-5943
• Publications:

  Wars2 is a determinant of angiogenesis. Nat Commun. 7, 12061 (2016). 27389904

Target Info

• Gene Symbol: WARS2
• Gene Full Name: Tryptophanyl tRNA synthetase 2, mitochondrial
• Alias Symbols: TrpRS, NEMMLAS, mtTrpRS
• NCBI Gene Id: 10352
• Protein Name: Tryptophan--tRNA ligase, mitochondrial
• Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase. Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described.
• Uniprot ID: Q9UGM6
• Protein Accession #: NP_957715
• Nucleotide Accession #: NM_201263
• Protein Size (# AA): 220
• Molecular Weight: 24kDa
• Protein Interactions: UBC; APP;