Loading...
Catalog No: ARP58550_P050
Price: $0.00
SKU
ARP58550_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-WARS (ARP58550_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human WARS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF
Concentration0.5 mg/ml
Blocking PeptideFor anti-WARS (ARP58550_P050) antibody is Catalog # AAP58550 (Previous Catalog # AAPP34832)
ReferenceShen,N., (2008) Nucleic Acids Res. 36 (4), 1288-1299
Gene SymbolWARS
Gene Full NameTryptophanyl-tRNA synthetase
Alias SymbolsHMN9, WARS, IFI53, IFP53, GAMMA-2
NCBI Gene Id7453
Protein NameTryptophan--tRNA ligase, cytoplasmic
Description of TargetAminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.
Uniprot IDP23381
Protein Accession #NP_004175
Nucleotide Accession #NM_004184
Protein Size (# AA)471
Molecular Weight52kDa
Protein InteractionsUBC; SUMO2; CDC34; CALU; ADSL; AARS; CTPS2; HERC4; NT5C2; FKBP9; EHD1; GNPDA1; GTF3C4; USP5; XPNPEP1; RAD23A; TWF1; PCNA; NUCB1; KTN1; GTF2I; CD81; LIG4; TRIM25; GART; APP; ISG15; TERF1; SIRT7; PSMA3; DNMT3B; DCAF13; DDA1; GBAS; CDK2AP2; MDH2; EEF1A1;
  1. What is the species homology for "WARS Antibody - N-terminal region (ARP58550_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "WARS Antibody - N-terminal region (ARP58550_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WARS Antibody - N-terminal region (ARP58550_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WARS Antibody - N-terminal region (ARP58550_P050)"?

    This target may also be called "HMN9, WARS, IFI53, IFP53, GAMMA-2" in publications.

  5. What is the shipping cost for "WARS Antibody - N-terminal region (ARP58550_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WARS Antibody - N-terminal region (ARP58550_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WARS Antibody - N-terminal region (ARP58550_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WARS Antibody - N-terminal region (ARP58550_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "WARS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WARS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WARS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WARS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WARS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WARS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WARS Antibody - N-terminal region (ARP58550_P050)
Your Rating
We found other products you might like!