Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP67906_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP67906_P050-FITC Conjugated

ARP67906_P050-HRP Conjugated

ARP67906_P050-Biotin Conjugated

VWC2 Antibody - N-terminal region (ARP67906_P050)

Catalog#: ARP67906_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-138721 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human VWC2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: LEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGR
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-VWC2 (ARP67906_P050) antibody is Catalog # AAP67906
Datasheets/ManualsPrintable datasheet for anti-VWC2 (ARP67906_P050) antibody
Gene SymbolVWC2
Alias SymbolsPSST739, UNQ739
NCBI Gene Id375567
Protein NameBrorin
Description of TargetThis gene encodes a secreted bone morphogenic protein antagonist. The encoded protein is possibly involved in neural function and development and may have a role in cell adhesion.
Swissprot IdQ2TAL6
Protein Accession #NP_940972
Nucleotide Accession #NM_198570
Protein Size (# AA)325
Molecular Weight36kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express VWC2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express VWC2.
Write Your Own Review
You're reviewing:VWC2 Antibody - N-terminal region (ARP67906_P050)
Your Rating
Aviva Blast Tool
Aviva ChIP Antibodies
Aviva Pathways
Aviva Tissue Tool