Search Antibody, Protein, and ELISA Kit Solutions

VWC2 Antibody - N-terminal region (ARP67906_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP67906_P050-FITC Conjugated

ARP67906_P050-HRP Conjugated

ARP67906_P050-Biotin Conjugated

Gene Symbol:
VWC2
NCBI Gene Id:
375567
Protein Name:
Brorin
Swissprot Id:
Q2TAL6
Protein Accession #:
NP_940972
Nucleotide Accession #:
NM_198570
Alias Symbols:
PSST739, UNQ739
Replacement Item:
This antibody may replace item sc-138721 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a secreted bone morphogenic protein antagonist. The encoded protein is possibly involved in neural function and development and may have a role in cell adhesion.
Protein Size (# AA):
325
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VWC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VWC2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VWC2
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: LEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-VWC2 (ARP67906_P050) antibody is Catalog # AAP67906
Datasheets/Manuals:
Printable datasheet for anti-VWC2 (ARP67906_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...