Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Vwa5a antibody - C-terminal region (ARP55094_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP55094_P050-FITC Conjugated

ARP55094_P050-HRP Conjugated

ARP55094_P050-Biotin Conjugated

Gene Symbol:
Vwa5a
NCBI Gene Id:
67776
Official Gene Full Name:
Von Willebrand factor A domain containing 5A
Protein Name:
von Willebrand factor A domain-containing protein 5A
Swissprot Id:
Q99KC8
Protein Accession #:
NP_766355
Nucleotide Accession #:
NM_172767
Alias Symbols:
5830475I06Rik, AW552491, BCSC-1, E130119J22, Loh11cr2a
Replacement Item:
This antibody may replace item sc-137567 from Santa Cruz Biotechnology.
Description of Target:
Vwa5a may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in may contribute directly to or modify tumorigenesis.
Protein Size (# AA):
793
Molecular Weight:
87kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Vwa5a.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Vwa5a.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Guinea Pig: 79%; Horse: 83%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Complete computational species homology data:
Anti-Vwa5a (ARP55094_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Vwa5a (ARP55094_P050) antibody is Catalog # AAP55094 (Previous Catalog # AAPP32712)
Datasheets/Manuals:
Printable datasheet for anti-Vwa5a (ARP55094_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...