Vsx1 Antibody - C-terminal region : FITC (ARP37439_P050-FITC)

Catalog No: ARP37439_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Mouse, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Vsx1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Vsx1 (ARP37439_P050-FITC) antibody is Catalog # AAP37439

Target Info

• Gene Symbol: Vsx1
• Gene Full Name: visual system homeobox 1 homolog (zebrafish)
• Alias Symbols: CHX10-li, CHX10-like
• NCBI Gene Id: 114889
• Protein Name: Visual system homeobox 1
• Description of Target: Vsx1 binds to the 37-bp core of the locus control region (LCR) of the red/green visual pigment gene cluster. Vsx1 may regulate the activity of the LCR and the cone opsin genes at earlier stages of development.
• Uniprot ID: Q91V10
• Protein Accession #: NP_473409
• Nucleotide Accession #: NM_054068
• Protein Size (# AA): 363
• Molecular Weight: 39kDa
• Protein Interactions: Nkx2-1;