- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for VPS16 Antibody (OAAL00792) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 2F10 |
Isotype | IgG2a Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | VPS16 (NP_072097.2, 754 a.a. ~ 839 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | IGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | VPS16 |
---|---|
Gene Full Name | VPS16 core subunit of CORVET and HOPS complexes |
Alias Symbols | DYT30;hVPS16;vacuolar protein sorting 16 homolog;vacuolar protein sorting protein 16;vacuolar protein sorting-associated protein 16 homolog;VPS16, CORVET/HOPS core subunit. |
NCBI Gene Id | 64601 |
Protein Name | Homo sapiens VPS16, CORVET/HOPS core subunit (VPS16), transcript variant 1, mRNA|vacuolar protein sorting-associated protein 16 homolog isoform 1 [Homo sapiens] |
Description of Target | Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_072097.2 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_022575 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "VPS16 Antibody (OAAL00792)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "VPS16 Antibody (OAAL00792)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "VPS16 Antibody (OAAL00792)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "VPS16 Antibody (OAAL00792)"?
This target may also be called "DYT30;hVPS16;vacuolar protein sorting 16 homolog;vacuolar protein sorting protein 16;vacuolar protein sorting-associated protein 16 homolog;VPS16, CORVET/HOPS core subunit." in publications.
-
What is the shipping cost for "VPS16 Antibody (OAAL00792)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "VPS16 Antibody (OAAL00792)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "VPS16 Antibody (OAAL00792)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "VPS16 Antibody (OAAL00792)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "VPS16"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "VPS16"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "VPS16"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "VPS16"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "VPS16"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "VPS16"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.